PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 440aa    MW: 48547.2 Da    PI: 6.8782
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033236genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.32.7e-23146189144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+ep+rC+RtDGKkWRCsr+v +++k+CErH  ++r rsrk++e
  Lus10033236 146 DPEPWRCKRTDGKKWRCSRDVAPDHKYCERHTRKSRPRSRKPVE 189
                  79***************************************986 PP

2QLQ47.94e-1793124132
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                  s+FTaaQ+q+L+ Q  ++KyL+a++P+Pp+L+
  Lus10033236  93 SPFTAAQWQELEKQTIILKYLMASLPLPPHLI 124
                  89****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.9E-793129IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.1E-1194124IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166616.65494129IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.964146190IPR014977WRC domain
PfamPF088791.4E-18147189IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MVSSDEDDCG LALKLQKLPS CNDMALLIPH HHHHHDHGGE SGPLCFSRST NSVSSSSVPD  60
FTHIYNGALL PPPAADVFPP VSRSNHSPGE SESPFTAAQW QELEKQTIIL KYLMASLPLP  120
PHLIPKPPSN MARHSLELGI STRQSDPEPW RCKRTDGKKW RCSRDVAPDH KYCERHTRKS  180
RPRSRKPVEF HFDDNITMNH KPNLQGLIPS SYFPFLPPPA AAAADDSIPY ETPRNLEWVV  240
KGEANAVPSD YYYMRKDDKD SIFELDHHRE QQPTFPSTPY QCEWLGNDDH YNTWFCSLPK  300
STTSSTDAAT ATALSPGGLA QGQETRHFLD AWSTTAHSEK NYITRLDRKK SSPVSSADKA  360
TLPLTLSMCG GGGGSTETSY EVVEGTSLRT QWLSHGSWPM SSPPGGPLAE ALCLGIPSSR  420
SKSPPNLTSG INSSFPDKW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518921.13e-76PREDICTED: growth-regulating factor 8 isoform X1
TrEMBLB9RYV23e-76B9RYV2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s11480.13e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-25growth-regulating factor 2